PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g16672.1.p
Common NameBRADI_5g16672, LOC100841187
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 286aa    MW: 30327 Da    PI: 7.2091
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g16672.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.61.9e-151562148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W++eEd++l d++ ++G  +W+t++ + g+ R +k+c++rw +yl
  Bradi5g16672.1.p 15 KGLWSPEEDQKLRDYIIRYGHSCWSTVPVKAGLQRNGKSCRLRWINYL 62
                      678*******************************************97 PP

2Myb_DNA-binding53.26.9e-1769113248
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       g +++eE+e    +++ lG++ W++Ia++++ gRt++++k++w++yl
  Bradi5g16672.1.p  69 GMFSQEEEETVMSLHATLGNK-WSRIAQHLP-GRTDNEVKNYWNSYL 113
                       569******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.8241062IPR017930Myb domain
SuperFamilySSF466891.1E-2713109IPR009057Homeodomain-like
SMARTSM007177.1E-111464IPR001005SANT/Myb domain
PfamPF002496.8E-131562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.9E-211669IPR009057Homeodomain-like
CDDcd001673.51E-101862No hitNo description
PROSITE profilePS5129424.68763117IPR017930Myb domain
SMARTSM007179.4E-1467115IPR001005SANT/Myb domain
PfamPF002499.6E-1669113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2570116IPR009057Homeodomain-like
CDDcd001676.12E-1271113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0010018Biological Processfar-red light signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MGCKSCQKPK AHHRKGLWSP EEDQKLRDYI IRYGHSCWST VPVKAGLQRN GKSCRLRWIN  60
YLRPGLKHGM FSQEEEETVM SLHATLGNKW SRIAQHLPGR TDNEVKNYWN SYLKKRVEGA  120
QAAPAKSAGS DSPQSPTAAL SESGVKRPEN SGSSGPPESS SADDSSCLTG PAGAAAALIR  180
PHAPVLPKVM FADWLDMDMD YGTGLMAPGL DAGFGAGRCS SPAQGAASQQ GSVQVDGPSC  240
SAVDSLHGLG GGICWDFDAA DQMHMQSGGG GFCDLLSMSE FLGIN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-26151187109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580215.10.0PREDICTED: transcription factor LAF1-like
SwissprotQ9M0K42e-62LAF1_ARATH; Transcription factor LAF1
TrEMBLI1J0080.0I1J008_BRADI; Uncharacterized protein
STRINGBRADI5G16672.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.17e-63myb domain protein 19